>AGAP006730-PA gnl|CDD|65178 pfam01363, FYVE, FYVE zinc finger. The FYVE zinc f... 39 0.001 gnl|CDD|66967 pfam03326, Herpes_TAF50, Herpesvirus transcription... 31 0.28 gnl|CDD|70912 pfam07462, MSP1_C, Merozoite surface protein 1 (MS... 30 0.50 gnl|CDD|69147 pfam05609, LAP1C, Lamina-associated polypeptide 1C... 29 0.75 gnl|CDD|63985 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING... 30 0.77 ==> gnl|CDD|65178 pfam01363, FYVE, FYVE zinc finger. The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn++ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. We have included members which do not conserve these histidine residues but are clearly related.. Length = 65 Score = 38.8 bits (90), Expect = 0.001 Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 3 CEKCNVKFGIITRKKSCYECHRLFCRNCLSKR 34 C +C F + R+ C C R+FC +C SK Sbjct: 12 CMRCGKPFTLTKRRHHCRACGRIFCSSCSSKT 43 ==> gnl|CDD|66967 pfam03326, Herpes_TAF50, Herpesvirus transcription activation factor (transactivator). This family includes EBV BRLF1 and similar ORF 50 proteins from other herpesviruses.. Length = 500 Score = 30.8 bits (69), Expect = 0.28 Identities = 37/196 (18%), Positives = 57/196 (29%), Gaps = 21/196 (10%) Query: 139 QIKNTCQNLFSTFSEKINGGKCVRHAPEAGRASSGFATQEEQRHIFTQPRFGSNNVYHSY 198 +L S R + A+ + R + + Sbjct: 214 HGFTPHPSLPQPQSPLKPSPSSARPQQSESFSDVWPASTQSPREETSAEPLAPASPSSRR 273 Query: 199 DSGSMERSAHFSSASSGTTGGADTSAASSSFSTPSR---------EASAPLLAEQQPSAE 249 S + E SS + G + SS S PS P ++ Sbjct: 274 PSTAQEEQIACSSPQAEPEQGVQSYVPQSSDSRPSCFPAPSTTQPTFLPPNTNKKAKRDR 333 Query: 250 RDGAVTKQQEAGGKSE---PDVPQRSKQARRSHS------HSNLLSPVQAGPS---ADTS 297 R VT +QE G R+ + R S S +S LLS + PS + Sbjct: 334 RPQMVTPKQEGGAAVSQNHDGGTVRAPRGRPSGSGQSPPSNSPLLSSLADTPSGAAHQPA 393 Query: 298 AGTPPKVVTRSQTPSS 313 + PP VV + +S Sbjct: 394 SLLPPAVVQQQLEDAS 409 ==> gnl|CDD|70912 pfam07462, MSP1_C, Merozoite surface protein 1 (MSP1) C-terminus. This family represents the C-terminal region of merozoite surface protein 1 (MSP1) which are found in a number of Plasmodium species. MSP-1 is a 200-kDa protein expressed on the surface of the P. vivax merozoite. MSP-1 of Plasmodium species is synthesised as a high-molecular-weight precursor and then processed into several fragments. At the time of red cell invasion by the merozoite, only the 19-kDa C-terminal fragment (MSP-119), which contains two epidermal growth factor-like domains, remains on the surface. Antibodies against MSP-119 inhibit merozoite entry into red cells, and immunisation with MSP-119 protects monkeys from challenging infections. Hence, MSP-119 is considered a promising vaccine candidate.. Length = 574 Score = 30.0 bits (67), Expect = 0.50 Identities = 23/143 (16%), Positives = 44/143 (30%), Gaps = 25/143 (17%) Query: 254 VTKQQEAGGKSEPDVPQRSKQARRSHSHSNLLSPVQAGPSADTSAGTPPKVV-------- 305 + K + G + P+ +A + LL + T+ TPP+ Sbjct: 229 LIKNKNYTGNTNPENNPEVNEALE--QYKELLPKGTTQEAKVTTVVTPPQADAAPSPLSV 286 Query: 306 --------TRSQTPSSSFDDLLADGEGSSSNADHAIAQDATLAATTETDALGTTVASTDD 357 T + +L G ++ Q+ E D+L +D Sbjct: 287 RPAGSSGSASGSTQIPTSGSVLGPGAAATELQQVVQLQN----YDEEDDSLVVLPIFGND 342 Query: 358 TDQWQIIN---TSEANSATHSDL 377 D + ++ T EA S ++ Sbjct: 343 DDDDEDLDQVATGEAESEEMKNI 365 ==> gnl|CDD|69147 pfam05609, LAP1C, Lamina-associated polypeptide 1C (LAP1C). This family contains rat LAP1C proteins and several uncharacterised highly related sequences from both mice and humans. LAP1s (lamina-associated polypeptide 1s) are type 2 integral membrane proteins with a single membrane-spanning region of the inner nuclear membrane. LAP1s bind to both A- and B-type lamins and have a putative role in the membrane attachment and assembly of the nuclear lamina.. Length = 465 Score = 29.4 bits (65), Expect = 0.75 Identities = 25/125 (20%), Positives = 43/125 (34%), Gaps = 3/125 (2%) Query: 169 RASSGFATQEEQRHIFTQPRFGSNNVYHSYDSGSMERSAHFSSASSGTTGGADTSAASSS 228 R AT+ + + F + ++ + S + + E S S G + SS Sbjct: 81 RYPRYEATEVQNKQSFLEEGETEDDHHSSSSNVTKEPLRSRDSHESSDKVGRADAHLGSS 140 Query: 229 FSTPSREASAPLLAEQQPSAERDGAVTKQQE---AGGKSEPDVPQRSKQARRSHSHSNLL 285 + AS QQPS G+ QE G+ + +R + + S Sbjct: 141 SWALPKSASDFTAHSQQPSVLTTGSQKAPQEWHSQAGRERTRMLRRRILKSEAGNQSPST 200 Query: 286 SPVQA 290 S +Q Sbjct: 201 SKLQE 205 ==> gnl|CDD|63985 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger). The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid. Many proteins containing a RING finger play a key role in the ubiquitination pathway.. Length = 41 Score = 29.6 bits (66), Expect = 0.77 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 8/42 (19%) Query: 674 CKICMDAPIECV-ILECGHMTTCTAC------GKVLSECPIC 708 C+IC++ + IL CGH C +C + CP+C Sbjct: 1 CRICLEELKDPSTILPCGH-RFCRSCLKRWLSTSGNTTCPLC 41