>AGAP007293-PA gnl|CDD|64515 pfam00653, BIR, Inhibitor of Apoptosis domain. BIR... 91 1e-019 gnl|CDD|64456 pfam00591, Glycos_transf_3, Glycosyl transferase f... 30 0.24 gnl|CDD|71404 pfam07967, zf-C3HC, C3HC zinc finger-like. This zi... 28 0.75 ==> gnl|CDD|64515 pfam00653, BIR, Inhibitor of Apoptosis domain. BIR stands for 'Baculovirus Inhibitor of apoptosis protein Repeat'. It is found repeated in inhibitor of apoptosis proteins (IAPs), and in fact it is also known as IAP repeat. These domains characteristically have a number of invariant residues, including 3 conserved cysteines and one conserved histidine that coordinate a zinc ion. They are usually made up of 4-5 alpha helices and a three-stranded beta-sheet. BIR is also found in other proteins known as BIR-domain-containing proteins (BIRPs), such as Survivin.. Length = 66 Score = 91.1 bits (226), Expect = 1e-019 Identities = 34/66 (51%), Positives = 43/66 (65%) Query: 181 RLATFKEWPKSIPQTPTQMADAGFFYTGKSDVVACYYCGGNLRDWLAEDDPWVEHVRNFS 240 RL TF+ WP S Q P Q+A AGF+YTG D V C++CG L++W DDPW EH R Sbjct: 1 RLRTFQNWPISNLQFPEQLAKAGFYYTGVGDEVRCFFCGVELKNWEPGDDPWEEHARWSP 60 Query: 241 ECPYVK 246 CP+V+ Sbjct: 61 NCPFVR 66 Score = 71.1 bits (174), Expect = 1e-013 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Query: 33 RLRTFPLWTVP-YIYPEELARWGFFYTGYRDCVRCYFCRIELGGWDEHDVVIEEHLKWSP 91 RLRTF W + +PE+LA+ GF+YTG D VRC+FC +EL W+ D EEH +WSP Sbjct: 1 RLRTFQNWPISNLQFPEQLAKAGFYYTGVGDEVRCFFCGVELKNWEPGDDPWEEHARWSP 60 Query: 92 HCRLM 96 +C + Sbjct: 61 NCPFV 65 ==> gnl|CDD|64456 pfam00591, Glycos_transf_3, Glycosyl transferase family, a/b domain. This family includes anthranilate phosphoribosyltransferase (TrpD), thymidine phosphorylase. All these proteins can transfer a phosphorylated ribose substrate.. Length = 254 Score = 29.8 bits (67), Expect = 0.24 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 9/36 (25%) Query: 120 DTTGTG---------STSAWSAAATAAVAVAMESNR 146 D GTG ST+A AA V VA NR Sbjct: 6 DIVGTGGDGDNTFNISTAAAFVAAACGVKVAKHGNR 41 ==> gnl|CDD|71404 pfam07967, zf-C3HC, C3HC zinc finger-like. This zinc-finger like domain is distributed throughout the eukaryotic kingdom in NIPA (Nuclear interacting partner of ALK) proteins. NIPA is implicate to perform some sort of antiapoptotic role in nucleophosmin-anaplastic lymphoma kinase (ALK) mediated signaling events. The domain is often repeated, with the second domain usually containing a large insert (approximately 90 residues) after the first three cysteine residues. The Schizosaccharomyces pombe the protein containing this domain is involved in mRNA export from the nucleus.. Length = 132 Score = 28.4 bits (63), Expect = 0.75 Identities = 21/74 (28%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Query: 180 DRLATFKE-WPKSIPQT--PTQMADAGFFYTGKSDVVACYYCGGNLRDWLAEDDPWVEHV 236 RLATFK P P A G+ K D++ C CG L L V+ V Sbjct: 9 RRLATFKSLTWFGKPSAVSPVNCAKRGWVCVSK-DMLKCVSCGAYLCVSLPNVLDEVKEV 67 Query: 237 RNFSECPYVKLVKT 250 K ++T Sbjct: 68 YEKRGEKLAKQLET 81