>AGAP010647-PA gnl|CDD|65416 pfam01616, Orbi_NS3, Orbivirus NS3. The function o... 26 0.55 ==> gnl|CDD|65416 pfam01616, Orbi_NS3, Orbivirus NS3. The function of this Orbivirus non structural protein is uncertain. However it may play a role on release of the virus from infected cells.. Length = 206 Score = 26.5 bits (58), Expect = 0.55 Identities = 14/57 (24%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Query: 1 MSRIVSFISPVPLFLLLSLATLRGDPFVALRTSTTNRTLLCWAIKLSPTAYVTDAEC 57 + I+ I V + LL S T+ + L+ + T+ W K S T +V + Sbjct: 97 ILHIILLICAV-VTLLTSFLTMASGLSIILQYNGTDLADPSWLKKWSKTLHVINLIL 152