>AGAP011110-PA gnl|CDD|71993 pfam08567, TFIIH_BTF_p62_N, TFIIH p62 subunit, N-t... 87 3e-018 gnl|CDD|67520 pfam03909, BSD, BSD domain. This domain contains a... 69 1e-012 gnl|CDD|69480 pfam05960, DUF885, Bacterial protein of unknown fu... 29 0.83 ==> gnl|CDD|71993 pfam08567, TFIIH_BTF_p62_N, TFIIH p62 subunit, N-terminal domain. The N-terminal domain of the TFIIH basal transcription factor complex p62 subunit (BTF2-p62) forms an interaction with the 3' endonuclease XPG, which is essential for activity. The 3' endonuclease XPG is a major component of the nucleotide excision repair machinery. The structure of the N-terminal domain reveals that it adopts a pleckstrin homology (PH) fold.. Length = 74 Score = 87.3 bits (216), Expect = 3e-018 Identities = 30/74 (40%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Query: 10 LQMGEVRFKKGDGTLYVMNE-RIAWIAEHRDTVA-VSHRFQDIKMQKISPEGKPKVQLQV 67 L G V+FKK DGTL + ++ R+ W D V +S F DIK + SP KV L++ Sbjct: 1 LHSGAVKFKKVDGTLSLTSDSRLIWRPTDGDKVPTISLNFSDIKNLQASPASSAKVMLRL 60 Query: 68 VLHDGNSSTFHFVN 81 VL + + +TF F N Sbjct: 61 VLKNDDPATFVFSN 74 ==> gnl|CDD|67520 pfam03909, BSD, BSD domain. This domain contains a distinctive -FW- motif. It is found in a family of eukaryotic transcription factors as well as a set of proteins of unknown function.. Length = 66 Score = 68.5 bits (167), Expect = 1e-012 Identities = 16/63 (25%), Positives = 31/63 (49%) Query: 173 DIKPQTDGCNGLRYNLTADIIECIFKTYPAVKRKHTDNVPAKMTEAEFWTKFFQSHYFHR 232 D+KP N + + I+ + K PA+++ + + VP K++E EFW ++F Sbjct: 1 DLKPSDLWDNEFDLDEKQEEIQALLKEDPALRKLYNELVPKKVSEEEFWARYFYLLRAIA 60 Query: 233 DRI 235 + Sbjct: 61 LKE 63 Score = 55.4 bits (133), Expect = 1e-008 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 97 ELLQQLLPNFRRKIDKELEEKNRILTENPSLLQLYKDLVITQVLTSEEFWARHAKEYMNK 156 +L L + +D++ EE +L E+P+L +LY +LV +V + EEFWAR+ Sbjct: 1 DLKPSDLWDNEFDLDEKQEEIQALLKEDPALRKLYNELVPKKV-SEEEFWARYFYLLRAI 59 Query: 157 EQTVRQ 162 Q Sbjct: 60 ALKEEQ 65 ==> gnl|CDD|69480 pfam05960, DUF885, Bacterial protein of unknown function (DUF885). This family consists of several hypothetical bacterial proteins several of which are putative membrane proteins.. Length = 546 Score = 29.1 bits (65), Expect = 0.83 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 248 GKIDDQQLRQSVQENLGDPLLDIRAFEDNTLEEG 281 G++ +LR+ ++ LGD DIRAF D L G Sbjct: 499 GELKILRLREKAEKALGDKF-DIRAFHDAVLLNG 531