>AGAP010647-PA gnl|CDD|47370 smart00020, Tryp_SPc, Trypsin-like serine protease... 24 0.25 gnl|CDD|47671 smart00344, HTH_ASNC, helix_turn_helix ASNC type; ... 22 0.55 ==> gnl|CDD|47370 smart00020, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues. . Length = 231 Score = 23.8 bits (51), Expect = 0.25 Identities = 11/47 (23%), Positives = 15/47 (31%), Gaps = 1/47 (2%) Query: 26 PFVALRTSTTNRTLLCWAIKLSPTAYVTDAECVRSHRKHQIVMIYGD 72 P+ R C +SP +T A CV I + G Sbjct: 14 PWQVSLQYRGGR-HFCGGSLISPRWVLTAAHCVYGSAPSSIRVRLGS 59 ==> gnl|CDD|47671 smart00344, HTH_ASNC, helix_turn_helix ASNC type; AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli) . Length = 104 Score = 22.4 bits (48), Expect = 0.55 Identities = 9/27 (33%), Positives = 10/27 (37%), Gaps = 1/27 (3%) Query: 77 RTVQERLGRKVAGLRQPACRYRVPSLV 103 R L +KV GL RV L Sbjct: 17 RISLAELAKKV-GLSPSTVHNRVKRLE 42